A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10746
Swiss-prot Accession number	P20392 (Sequence in FASTA format)
Description	Somatotropin (Growth hormone).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	190 Amino acids
Molecular weight	21761
References	1   Hulmes J.D., Miedel M.C., Li C.H., Pan Y.C.E.; "Primary structure of elephant growth hormone."; Int. J. Pept. Protein Res. 33:368-372(1989).
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRPGQVLKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (1-190)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10928
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEGESAEAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (1-39)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10929
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (1-13)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10930
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELARERPEPARGPEGPDEGAATQADLDNGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
Position of mature hormone in Pre-Hormone protein	93 Residues from position (42-134)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10931
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	N/A
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELARERPEPARGPEGPDEGAATQADLDNGLVAEVEATSAEKKDEGPYKMEHFRWGSPAKD
Position of mature hormone in Pre-Hormone protein	60 Residues from position (42-101)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10932
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DEGPYKMEHFRWGSPAKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (84-101)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10933
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGH
Position of mature hormone in Pre-Hormone protein	31 Residues from position (104-134)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10934
Swiss-prot Accession number	P21252 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH); Beta-endorphin; Met-enkephalin](Fragment).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous peptide
Protein Length	134 Amino acids
Molecular weight	14935
References	1  PubMed abstract 2854538 2  PubMed abstract 2854538
Domain Name	ACTH_domain  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (104-108)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	11018
Swiss-prot Accession number	P10765 (Sequence in FASTA format)
Description	Prolactin (PRL).
Source organism	Loxodonta africana (African elephant)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Afrotheria; Proboscidea; Elephantidae; Loxodonta.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation
Protein Length	199 Amino acids
Molecular weight	22673
References	1  PubMed abstract 2722400
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	IPVCPRGSVRCQVSLPDLFDRAVMLSHYIHSLSSDMFHEFNKQYALGRGFIPRAINSCHTSSISTPEDKDQAQQTHHEVLMDLILGLLRSWNDPLDHLASEVHSLPKAPSALLTKATEVKEENQRLLEGIEKIVDQVHPGAKENKAYSVWSGLPSLQTTDEDARLFAFYNLFRCLRRDSHKIDSYLKLLKCRIVYNNNC
Position of mature hormone in Pre-Hormone protein	199 Residues from position (1-199)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated